TCF7,TCF-1
  • TCF7,TCF-1

Anti-TCF7 Antibody 25ul

Ref: AN-HPA070505-25ul
Anti-TCF7

Información del producto

Polyclonal Antibody against Human TCF7, Gene description: transcription factor 7 (T-cell specific, HMG-box), Alternative Gene Names: TCF-1, Validated applications: ICC, WB, Uniprot ID: P36402, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TCF7
Gene Description transcription factor 7 (T-cell specific, HMG-box)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAK
Immunogen KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TCF-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P36402
HTS Code 3002150000
Gene ID 6932
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TCF7 Antibody 25ul

Anti-TCF7 Antibody 25ul