KITLG,FPH2,Kitl
  • KITLG,FPH2,Kitl

Anti-KITLG Antibody 100ul

Ref: AN-HPA070395-100ul
Anti-KITLG

Información del producto

Polyclonal Antibody against Human KITLG, Gene description: KIT ligand, Alternative Gene Names: FPH2, Kitl, KL-1, MGF, SCF, SF, Validated applications: IHC, Uniprot ID: P21583, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KITLG
Gene Description KIT ligand
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YWKKRQPSLTRAVENIQINEEDNEISMLQEK
Immunogen YWKKRQPSLTRAVENIQINEEDNEISMLQEK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FPH2, Kitl, KL-1, MGF, SCF, SF
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P21583
HTS Code 3002150000
Gene ID 4254
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KITLG Antibody 100ul

Anti-KITLG Antibody 100ul