HOXD4,HOX4,HOX4B
  • HOXD4,HOX4,HOX4B

Anti-HOXD4 Antibody 100ul

Ref: AN-HPA070349-100ul
Anti-HOXD4

Información del producto

Polyclonal Antibody against Human HOXD4, Gene description: homeobox D4, Alternative Gene Names: HOX4, HOX4B, Validated applications: ICC, IHC, Uniprot ID: P09016, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HOXD4
Gene Description homeobox D4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV
Immunogen ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HOX4, HOX4B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09016
HTS Code 3002150000
Gene ID 3233
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HOXD4 Antibody 100ul

Anti-HOXD4 Antibody 100ul