MAPK8IP1,IB1,JIP-1
  • MAPK8IP1,IB1,JIP-1

Anti-MAPK8IP1 Antibody 25ul

Ref: AN-HPA070332-25ul
Anti-MAPK8IP1

Información del producto

Polyclonal Antibody against Human MAPK8IP1, Gene description: mitogen-activated protein kinase 8 interacting protein 1, Alternative Gene Names: IB1, JIP-1, JIP1, PRKM8IP, Validated applications: ICC, Uniprot ID: Q9UQF2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAPK8IP1
Gene Description mitogen-activated protein kinase 8 interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFLPPTESRMSVSSDPDPAAY
Immunogen GHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFLPPTESRMSVSSDPDPAAY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IB1, JIP-1, JIP1, PRKM8IP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UQF2
HTS Code 3002150000
Gene ID 9479
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAPK8IP1 Antibody 25ul

Anti-MAPK8IP1 Antibody 25ul