ISOC1,CGI-111
  • ISOC1,CGI-111

Anti-ISOC1 Antibody 100ul

Ref: AN-HPA070307-100ul
Anti-ISOC1

Información del producto

Polyclonal Antibody against Human ISOC1, Gene description: isochorismatase domain containing 1, Alternative Gene Names: CGI-111, Validated applications: ICC, Uniprot ID: Q96CN7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ISOC1
Gene Description isochorismatase domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence HIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Immunogen HIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-111
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96CN7
HTS Code 3002150000
Gene ID 51015
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ISOC1 Antibody 100ul

Anti-ISOC1 Antibody 100ul