MYH14,DFNA4
  • MYH14,DFNA4

Anti-MYH14 Antibody 25ul

Ref: AN-HPA070260-25ul
Anti-MYH14

Información del producto

Polyclonal Antibody against Human MYH14, Gene description: myosin, heavy chain 14, non-muscle, Alternative Gene Names: DFNA4, FLJ13881, KIAA2034, MHC16, MYH17, Validated applications: IHC, Uniprot ID: Q7Z406, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MYH14
Gene Description myosin, heavy chain 14, non-muscle
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE
Immunogen GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DFNA4, FLJ13881, KIAA2034, MHC16, MYH17
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z406
HTS Code 3002150000
Gene ID 79784
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MYH14 Antibody 25ul

Anti-MYH14 Antibody 25ul