PSMG1,c21-LRP,DSCR2
  • PSMG1,c21-LRP,DSCR2

Anti-PSMG1 Antibody 100ul

Ref: AN-HPA070225-100ul
Anti-PSMG1

Información del producto

Polyclonal Antibody against Human PSMG1, Gene description: proteasome (prosome, macropain) assembly chaperone 1, Alternative Gene Names: c21-LRP, DSCR2, LRPC21, PAC1, Validated applications: ICC, WB, Uniprot ID: O95456, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PSMG1
Gene Description proteasome (prosome, macropain) assembly chaperone 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence THLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPF
Immunogen THLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names c21-LRP, DSCR2, LRPC21, PAC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95456
HTS Code 3002150000
Gene ID 8624
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PSMG1 Antibody 100ul

Anti-PSMG1 Antibody 100ul