AFF1,AF-4,AF4,MLLT2
  • AFF1,AF-4,AF4,MLLT2

Anti-AFF1 Antibody 100ul

Ref: AN-HPA069947-100ul
Anti-AFF1

Información del producto

Polyclonal Antibody against Human AFF1, Gene description: AF4/FMR2 family, member 1, Alternative Gene Names: AF-4, AF4, MLLT2, PBM1, Validated applications: ICC, Uniprot ID: P51825, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AFF1
Gene Description AF4/FMR2 family, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK
Immunogen VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AF-4, AF4, MLLT2, PBM1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51825
HTS Code 3002150000
Gene ID 4299
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-AFF1 Antibody 100ul

Anti-AFF1 Antibody 100ul