GTF3C5,TFiiiC2-63
  • GTF3C5,TFiiiC2-63

Anti-GTF3C5 Antibody 25ul

Ref: AN-HPA069805-25ul
Anti-GTF3C5

Información del producto

Polyclonal Antibody against Human GTF3C5, Gene description: general transcription factor IIIC, polypeptide 5, 63kDa, Alternative Gene Names: TFiiiC2-63, TFIIIC63, TFIIICepsilon, Validated applications: ICC, WB, Uniprot ID: Q9Y5Q8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GTF3C5
Gene Description general transcription factor IIIC, polypeptide 5, 63kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence KTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHR
Immunogen KTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TFiiiC2-63, TFIIIC63, TFIIICepsilon
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5Q8
HTS Code 3002150000
Gene ID 9328
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GTF3C5 Antibody 25ul

Anti-GTF3C5 Antibody 25ul