KLRD1,CD94
  • KLRD1,CD94

Anti-KLRD1 Antibody 100ul

Ref: AN-HPA069688-100ul
Anti-KLRD1

Información del producto

Polyclonal Antibody against Human KLRD1, Gene description: killer cell lectin-like receptor subfamily D, member 1, Alternative Gene Names: CD94, Validated applications: IHC, Uniprot ID: Q13241, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KLRD1
Gene Description killer cell lectin-like receptor subfamily D, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNA
Immunogen IEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD94
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13241
HTS Code 3002150000
Gene ID 3824
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KLRD1 Antibody 100ul

Anti-KLRD1 Antibody 100ul