KDM4C,GASC1,JMJD2C
  • KDM4C,GASC1,JMJD2C

Anti-KDM4C Antibody 25ul

Ref: AN-HPA069357-25ul
Anti-KDM4C

Información del producto

Polyclonal Antibody against Human KDM4C, Gene description: lysine (K)-specific demethylase 4C, Alternative Gene Names: GASC1, JMJD2C, KIAA0780, TDRD14C, Validated applications: ICC, Uniprot ID: Q9H3R0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KDM4C
Gene Description lysine (K)-specific demethylase 4C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK
Immunogen ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GASC1, JMJD2C, KIAA0780, TDRD14C
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H3R0
HTS Code 3002150000
Gene ID 23081
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KDM4C Antibody 25ul

Anti-KDM4C Antibody 25ul