GTF3C3,TFIIIC102
  • GTF3C3,TFIIIC102

Anti-GTF3C3 Antibody 25ul

Ref: AN-HPA069179-25ul
Anti-GTF3C3

Información del producto

Polyclonal Antibody against Human GTF3C3, Gene description: general transcription factor IIIC, polypeptide 3, 102kDa, Alternative Gene Names: TFIIIC102, TFiiiC2-102, Validated applications: ICC, Uniprot ID: Q9Y5Q9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GTF3C3
Gene Description general transcription factor IIIC, polypeptide 3, 102kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGD
Immunogen RETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TFIIIC102, TFiiiC2-102
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5Q9
HTS Code 3002150000
Gene ID 9330
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GTF3C3 Antibody 25ul

Anti-GTF3C3 Antibody 25ul