ADH6,ADH-5
  • ADH6,ADH-5

Anti-ADH6 Antibody 100ul

Ref: AN-HPA069081-100ul
Anti-ADH6

Información del producto

Polyclonal Antibody against Human ADH6, Gene description: alcohol dehydrogenase 6 (class V), Alternative Gene Names: ADH-5, Validated applications: IHC, WB, Uniprot ID: P28332, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ADH6
Gene Description alcohol dehydrogenase 6 (class V)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VADYMAEKLNLDPLITHTLNLDKINEAVELMKTGKW
Immunogen VADYMAEKLNLDPLITHTLNLDKINEAVELMKTGKW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ADH-5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P28332
HTS Code 3002150000
Gene ID 130
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ADH6 Antibody 100ul

Anti-ADH6 Antibody 100ul