CDK2AP1,doc-1,DOC1
  • CDK2AP1,doc-1,DOC1

Anti-CDK2AP1 Antibody 100ul

Ref: AN-HPA068833-100ul
Anti-CDK2AP1

Información del producto

Polyclonal Antibody against Human CDK2AP1, Gene description: cyclin-dependent kinase 2 associated protein 1, Alternative Gene Names: doc-1, DOC1, DORC1, p12DOC-1, ST19, Validated applications: ICC, Uniprot ID: O14519, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CDK2AP1
Gene Description cyclin-dependent kinase 2 associated protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MSYKPNLAAHMPAAALNAAGSVHSPSTSMA
Immunogen MSYKPNLAAHMPAAALNAAGSVHSPSTSMA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names doc-1, DOC1, DORC1, p12DOC-1, ST19
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14519
HTS Code 3002150000
Gene ID 8099
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CDK2AP1 Antibody 100ul

Anti-CDK2AP1 Antibody 100ul