SOCS3,CIS3,Cish3
  • SOCS3,CIS3,Cish3

Anti-SOCS3 Antibody 100ul

Ref: AN-HPA068569-100ul
Anti-SOCS3

Información del producto

Polyclonal Antibody against Human SOCS3, Gene description: suppressor of cytokine signaling 3, Alternative Gene Names: CIS3, Cish3, SOCS-3, SSI-3, Validated applications: ICC, Uniprot ID: O14543, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SOCS3
Gene Description suppressor of cytokine signaling 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Immunogen FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CIS3, Cish3, SOCS-3, SSI-3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14543
HTS Code 3002150000
Gene ID 9021
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SOCS3 Antibody 100ul

Anti-SOCS3 Antibody 100ul