TTI1,KIAA0406,smg-10
  • TTI1,KIAA0406,smg-10

Anti-TTI1 Antibody 100ul

Ref: AN-HPA068338-100ul
Anti-TTI1

Información del producto

Polyclonal Antibody against Human TTI1, Gene description: TELO2 interacting protein 1, Alternative Gene Names: KIAA0406, smg-10, Validated applications: ICC, Uniprot ID: O43156, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TTI1
Gene Description TELO2 interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ERLDLGEGDLNKVADACLIYLSVKQPVKLQEAARSVFLHLMKVDPDSTWFLLNELYCPVQFTPPHPSLHPVQLHGASGQQNPYTT
Immunogen ERLDLGEGDLNKVADACLIYLSVKQPVKLQEAARSVFLHLMKVDPDSTWFLLNELYCPVQFTPPHPSLHPVQLHGASGQQNPYTT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0406, smg-10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43156
HTS Code 3002150000
Gene ID 9675
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TTI1 Antibody 100ul

Anti-TTI1 Antibody 100ul