SPAG8,BS-84,CILD28
  • SPAG8,BS-84,CILD28

Anti-SPAG8 Antibody 100ul

Ref: AN-HPA068012-100ul
Anti-SPAG8

Información del producto

Polyclonal Antibody against Human SPAG8, Gene description: sperm associated antigen 8, Alternative Gene Names: BS-84, CILD28, CT142, HSD-1, hSMP-1, SPAG3, Validated applications: IHC, Uniprot ID: Q99932, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPAG8
Gene Description sperm associated antigen 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVPNYTSWSQHCPWEPQKQPPWEFLQVLEPGARGLWKP
Immunogen PGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVPNYTSWSQHCPWEPQKQPPWEFLQVLEPGARGLWKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BS-84, CILD28, CT142, HSD-1, hSMP-1, SPAG3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99932
HTS Code 3002150000
Gene ID 26206
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPAG8 Antibody 100ul

Anti-SPAG8 Antibody 100ul