ODF3L2,C19orf19
  • ODF3L2,C19orf19

Anti-ODF3L2 Antibody 25ul

Ref: AN-HPA067973-25ul
Anti-ODF3L2

Información del producto

Polyclonal Antibody against Human ODF3L2, Gene description: outer dense fiber of sperm tails 3-like 2, Alternative Gene Names: C19orf19, FLJ40059, Validated applications: IHC, Uniprot ID: Q3SX64, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ODF3L2
Gene Description outer dense fiber of sperm tails 3-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGP
Immunogen VASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C19orf19, FLJ40059
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q3SX64
HTS Code 3002150000
Gene ID 284451
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ODF3L2 Antibody 25ul

Anti-ODF3L2 Antibody 25ul