GEMIN4,DKFZP434B131
  • GEMIN4,DKFZP434B131

Anti-GEMIN4 Antibody 25ul

Ref: AN-HPA067891-25ul
Anti-GEMIN4

Información del producto

Polyclonal Antibody against Human GEMIN4, Gene description: gem (nuclear organelle) associated protein 4, Alternative Gene Names: DKFZP434B131, DKFZP434D174, HC56, HCAP1, HHRF-1, p97, Validated applications: IHC, Uniprot ID: P57678, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GEMIN4
Gene Description gem (nuclear organelle) associated protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SQGTSYDSYRLCDSLTSFSQNATLYLNRTSLSKEDRQVVSELAECVRDFLRKTSTVLKNRALEDITASIAMAVIQQKMDRHMEVCYIFASEKKWAFSDEWV
Immunogen SQGTSYDSYRLCDSLTSFSQNATLYLNRTSLSKEDRQVVSELAECVRDFLRKTSTVLKNRALEDITASIAMAVIQQKMDRHMEVCYIFASEKKWAFSDEWV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434B131, DKFZP434D174, HC56, HCAP1, HHRF-1, p97
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P57678
HTS Code 3002150000
Gene ID 50628
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GEMIN4 Antibody 25ul

Anti-GEMIN4 Antibody 25ul