NR2C1,TR2,TR2-11
  • NR2C1,TR2,TR2-11

Anti-NR2C1 Antibody 25ul

Ref: AN-HPA067767-25ul
Anti-NR2C1

Información del producto

Polyclonal Antibody against Human NR2C1, Gene description: nuclear receptor subfamily 2, group C, member 1, Alternative Gene Names: TR2, TR2-11, Validated applications: IHC, Uniprot ID: P13056, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NR2C1
Gene Description nuclear receptor subfamily 2, group C, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
Immunogen QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TR2, TR2-11
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P13056
HTS Code 3002150000
Gene ID 7181
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NR2C1 Antibody 25ul

Anti-NR2C1 Antibody 25ul