GATA5,bB379O24.1
  • GATA5,bB379O24.1

Anti-GATA5 Antibody 100ul

Ref: AN-HPA067583-100ul
Anti-GATA5

Información del producto

Polyclonal Antibody against Human GATA5, Gene description: GATA binding protein 5, Alternative Gene Names: bB379O24.1, GATAS, Validated applications: ICC, Uniprot ID: Q9BWX5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GATA5
Gene Description GATA binding protein 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE
Immunogen GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bB379O24.1, GATAS
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BWX5
HTS Code 3002150000
Gene ID 140628
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GATA5 Antibody 100ul

Anti-GATA5 Antibody 100ul