EFNA2,ELF-1,EPLG6
  • EFNA2,ELF-1,EPLG6

Anti-EFNA2 Antibody 100ul

Ref: AN-HPA067567-100ul
Anti-EFNA2

Información del producto

Polyclonal Antibody against Human EFNA2, Gene description: ephrin A2, Alternative Gene Names: ELF-1, EPLG6, LERK6, Validated applications: ICC, Uniprot ID: O43921, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EFNA2
Gene Description ephrin A2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG
Immunogen PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ELF-1, EPLG6, LERK6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43921
HTS Code 3002150000
Gene ID 1943
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EFNA2 Antibody 100ul

Anti-EFNA2 Antibody 100ul