GABPB1,E4TF1-47
  • GABPB1,E4TF1-47

Anti-GABPB1 Antibody 25ul

Ref: AN-HPA067444-25ul
Anti-GABPB1

Información del producto

Polyclonal Antibody against Human GABPB1, Gene description: GA binding protein transcription factor, beta subunit 1, Alternative Gene Names: E4TF1-47, GABPB, GABPB2, Validated applications: ICC, Uniprot ID: Q06547, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GABPB1
Gene Description GA binding protein transcription factor, beta subunit 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK
Immunogen ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names E4TF1-47, GABPB, GABPB2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q06547
HTS Code 3002150000
Gene ID 2553
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GABPB1 Antibody 25ul

Anti-GABPB1 Antibody 25ul