NUFIP2,182-FIP
  • NUFIP2,182-FIP

Anti-NUFIP2 Antibody 25ul

Ref: AN-HPA067443-25ul
Anti-NUFIP2

Información del producto

Polyclonal Antibody against Human NUFIP2, Gene description: nuclear fragile X mental retardation protein interacting protein 2, Alternative Gene Names: 182-FIP, 82-FIP, FIP-82, KIAA1321, MGC117262, PIG1, Validated applications: ICC, Uniprot ID: Q7Z417, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NUFIP2
Gene Description nuclear fragile X mental retardation protein interacting protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG
Immunogen NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 182-FIP, 82-FIP, FIP-82, KIAA1321, MGC117262, PIG1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z417
HTS Code 3002150000
Gene ID 57532
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NUFIP2 Antibody 25ul

Anti-NUFIP2 Antibody 25ul