FAM163B,C9orf166
  • FAM163B,C9orf166

Anti-FAM163B Antibody 100ul

Ref: AN-HPA067336-100ul
Anti-FAM163B

Información del producto

Polyclonal Antibody against Human FAM163B, Gene description: family with sequence similarity 163, member B, Alternative Gene Names: C9orf166, Validated applications: ICC, IHC, Uniprot ID: P0C2L3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM163B
Gene Description family with sequence similarity 163, member B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence EEEPDFAVHSHLPPLHSNRNLVLTNGPALYPTASTSFSQKSPQARALCRSCSHCEPPTFFLQEPPEEEEDVLNGGERVLYKSVSQE
Immunogen EEEPDFAVHSHLPPLHSNRNLVLTNGPALYPTASTSFSQKSPQARALCRSCSHCEPPTFFLQEPPEEEEDVLNGGERVLYKSVSQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf166
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P0C2L3
HTS Code 3002150000
Gene ID 642968
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM163B Antibody 100ul

Anti-FAM163B Antibody 100ul