ITLN1,FLJ20022
  • ITLN1,FLJ20022

Anti-ITLN1 Antibody 25ul

Ref: AN-HPA067326-25ul
Anti-ITLN1

Información del producto

Polyclonal Antibody against Human ITLN1, Gene description: intelectin 1, Alternative Gene Names: FLJ20022, hIntL, HL-1, ITLN, LFR, Validated applications: IHC, Uniprot ID: Q8WWA0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ITLN1
Gene Description intelectin 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNS
Immunogen DGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20022, hIntL, HL-1, ITLN, LFR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WWA0
HTS Code 3002150000
Gene ID 55600
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ITLN1 Antibody 25ul

Anti-ITLN1 Antibody 25ul