C18orf21,HsT3108
  • C18orf21,HsT3108

Anti-C18orf21 Antibody 25ul

Ref: AN-HPA067322-25ul
Anti-C18orf21

Información del producto

Polyclonal Antibody against Human C18orf21, Gene description: chromosome 18 open reading frame 21, Alternative Gene Names: HsT3108, PNAS-124, PNAS-131, Validated applications: IHC, Uniprot ID: Q32NC0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C18orf21
Gene Description chromosome 18 open reading frame 21
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKG
Immunogen TCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HsT3108, PNAS-124, PNAS-131
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q32NC0
HTS Code 3002150000
Gene ID 83608
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C18orf21 Antibody 25ul

Anti-C18orf21 Antibody 25ul