TAF6L,PAF65A
  • TAF6L,PAF65A

Anti-TAF6L Antibody 25ul

Ref: AN-HPA067239-25ul
Anti-TAF6L

Información del producto

Polyclonal Antibody against Human TAF6L, Gene description: TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa, Alternative Gene Names: PAF65A, Validated applications: ICC, IHC, Uniprot ID: Q9Y6J9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TAF6L
Gene Description TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP
Immunogen LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PAF65A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6J9
HTS Code 3002150000
Gene ID 10629
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TAF6L Antibody 25ul

Anti-TAF6L Antibody 25ul