UPF2,DKFZP434D222
  • UPF2,DKFZP434D222

Anti-UPF2 Antibody 25ul

Ref: AN-HPA067008-25ul
Anti-UPF2

Información del producto

Polyclonal Antibody against Human UPF2, Gene description: UPF2 regulator of nonsense transcripts homolog (yeast), Alternative Gene Names: DKFZP434D222, KIAA1408, RENT2, smg-3, Validated applications: ICC, Uniprot ID: Q9HAU5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UPF2
Gene Description UPF2 regulator of nonsense transcripts homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGG
Immunogen LTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434D222, KIAA1408, RENT2, smg-3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HAU5
HTS Code 3002150000
Gene ID 26019
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UPF2 Antibody 25ul

Anti-UPF2 Antibody 25ul