CDC25C,CDC25,PPP1R60
  • CDC25C,CDC25,PPP1R60

Anti-CDC25C Antibody 25ul

Ref: AN-HPA066991-25ul
Anti-CDC25C

Información del producto

Polyclonal Antibody against Human CDC25C, Gene description: cell division cycle 25C, Alternative Gene Names: CDC25, PPP1R60, Validated applications: ICC, Uniprot ID: P30307, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CDC25C
Gene Description cell division cycle 25C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL
Immunogen MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CDC25, PPP1R60
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P30307
HTS Code 3002150000
Gene ID 995
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CDC25C Antibody 25ul

Anti-CDC25C Antibody 25ul