RP11-80H18.3
  • RP11-80H18.3

Anti-RP11-80H18.3 Antibody 25ul

Ref: AN-HPA066812-25ul
Anti-RP11-80H18.3

Información del producto

Polyclonal Antibody against Human RP11-80H18.3, Gene description: Hydroxyacyl-thioester dehydratase type 2, mitochondrial , Validated applications: ICC, Uniprot ID: P86397, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RP11-80H18.3
Gene Description Hydroxyacyl-thioester dehydratase type 2, mitochondrial
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKL
Immunogen VHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P86397
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RP11-80H18.3 Antibody 25ul

Anti-RP11-80H18.3 Antibody 25ul