PABPC1L,C20orf119
  • PABPC1L,C20orf119

Anti-PABPC1L Antibody 100ul

Ref: AN-HPA066650-100ul
Anti-PABPC1L

Información del producto

Polyclonal Antibody against Human PABPC1L, Gene description: poly(A) binding protein, cytoplasmic 1-like, Alternative Gene Names: C20orf119, dJ1069P2.3, ePAB, PABPC1L1, Validated applications: ICC, Uniprot ID: Q4VXU2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PABPC1L
Gene Description poly(A) binding protein, cytoplasmic 1-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP
Immunogen ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf119, dJ1069P2.3, ePAB, PABPC1L1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4VXU2
HTS Code 3002150000
Gene ID 80336
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PABPC1L Antibody 100ul

Anti-PABPC1L Antibody 100ul