DOK2,Dok-2,p56dok-2
  • DOK2,Dok-2,p56dok-2

Anti-DOK2 Antibody 100ul

Ref: AN-HPA066571-100ul
Anti-DOK2

Información del producto

Polyclonal Antibody against Human DOK2, Gene description: docking protein 2, Alternative Gene Names: Dok-2, p56dok-2, Validated applications: IHC, Uniprot ID: O60496, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DOK2
Gene Description docking protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK
Immunogen RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Dok-2, p56dok-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60496
HTS Code 3002150000
Gene ID 9046
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DOK2 Antibody 100ul

Anti-DOK2 Antibody 100ul