MYC,bHLHe39,c-Myc
  • MYC,bHLHe39,c-Myc

Anti-MYC Antibody 25ul

Ref: AN-HPA066556-25ul
Anti-MYC

Información del producto

Polyclonal Antibody against Human MYC, Gene description: v-myc avian myelocytomatosis viral oncogene homolog, Alternative Gene Names: bHLHe39, c-Myc, MYCC, Validated applications: ICC, Uniprot ID: P01106, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MYC
Gene Description v-myc avian myelocytomatosis viral oncogene homolog
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
Immunogen QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHe39, c-Myc, MYCC
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P01106
HTS Code 3002150000
Gene ID 4609
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MYC Antibody 25ul

Anti-MYC Antibody 25ul