TEAD2,ETF,TEF-4,TEF4
  • TEAD2,ETF,TEF-4,TEF4

Anti-TEAD2 Antibody 25ul

Ref: AN-HPA066292-25ul
Anti-TEAD2

Información del producto

Polyclonal Antibody against Human TEAD2, Gene description: TEA domain family member 2, Alternative Gene Names: ETF, TEF-4, TEF4, Validated applications: ICC, Uniprot ID: Q15562, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TEAD2
Gene Description TEA domain family member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDV
Immunogen TARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ETF, TEF-4, TEF4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15562
HTS Code 3002150000
Gene ID 8463
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TEAD2 Antibody 25ul

Anti-TEAD2 Antibody 25ul