IGFBP4,BP-4
  • IGFBP4,BP-4

Anti-IGFBP4 Antibody 25ul

Ref: AN-HPA066240-25ul
Anti-IGFBP4

Información del producto

Polyclonal Antibody against Human IGFBP4, Gene description: insulin-like growth factor binding protein 4, Alternative Gene Names: BP-4, HT29-IGFBP, IBP4, IGFBP-4, Validated applications: IHC, Uniprot ID: P22692, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IGFBP4
Gene Description insulin-like growth factor binding protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
Immunogen EDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BP-4, HT29-IGFBP, IBP4, IGFBP-4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P22692
HTS Code 3002150000
Gene ID 3487
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IGFBP4 Antibody 25ul

Anti-IGFBP4 Antibody 25ul