EIF3D,eIF3-p66
  • EIF3D,eIF3-p66

Anti-EIF3D Antibody 25ul

Ref: AN-HPA066216-25ul
Anti-EIF3D

Información del producto

Polyclonal Antibody against Human EIF3D, Gene description: eukaryotic translation initiation factor 3, subunit D, Alternative Gene Names: eIF3-p66, eIF3-zeta, eIF3d, EIF3S7, Validated applications: ICC, IHC, WB, Uniprot ID: O15371, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EIF3D
Gene Description eukaryotic translation initiation factor 3, subunit D
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence PQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDI
Immunogen PQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names eIF3-p66, eIF3-zeta, eIF3d, EIF3S7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15371
HTS Code 3002150000
Gene ID 8664
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EIF3D Antibody 25ul

Anti-EIF3D Antibody 25ul