DNASE2,DNL,DNL2
  • DNASE2,DNL,DNL2

Anti-DNASE2 Antibody 25ul

Ref: AN-HPA066185-25ul
Anti-DNASE2

Información del producto

Polyclonal Antibody against Human DNASE2, Gene description: deoxyribonuclease II, lysosomal, Alternative Gene Names: DNL, DNL2, Validated applications: IHC, Uniprot ID: O00115, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DNASE2
Gene Description deoxyribonuclease II, lysosomal
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSR
Immunogen NCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DNL, DNL2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00115
HTS Code 3002150000
Gene ID 1777
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DNASE2 Antibody 25ul

Anti-DNASE2 Antibody 25ul