DBX2,FLJ16139
  • DBX2,FLJ16139

Anti-DBX2 Antibody 25ul

Ref: AN-HPA066053-25ul
Anti-DBX2

Información del producto

Polyclonal Antibody against Human DBX2, Gene description: developing brain homeobox 2, Alternative Gene Names: FLJ16139, Validated applications: IHC, Uniprot ID: Q6ZNG2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DBX2
Gene Description developing brain homeobox 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLTG
Immunogen SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLTG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ16139
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZNG2
HTS Code 3002150000
Gene ID 440097
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DBX2 Antibody 25ul

Anti-DBX2 Antibody 25ul