C1QTNF3
  • C1QTNF3

Anti-C1QTNF3 Antibody 100ul

Ref: AN-HPA066011-100ul
Anti-C1QTNF3

Información del producto

Polyclonal Antibody against Human C1QTNF3, Gene description: C1q and tumor necrosis factor related protein 3, Alternative Gene Names: 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3, Validated applications: ICC, Uniprot ID: Q9BXJ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C1QTNF3
Gene Description C1q and tumor necrosis factor related protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG
Immunogen CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BXJ4
HTS Code 3002150000
Gene ID 114899
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C1QTNF3 Antibody 100ul

Anti-C1QTNF3 Antibody 100ul