CWC27,NY-CO-10
  • CWC27,NY-CO-10

Anti-CWC27 Antibody 25ul

Ref: AN-HPA065809-25ul
Anti-CWC27

Información del producto

Polyclonal Antibody against Human CWC27, Gene description: CWC27 spliceosome-associated protein homolog, Alternative Gene Names: NY-CO-10, SDCCAG-10, SDCCAG10, Validated applications: ICC, WB, Uniprot ID: Q6UX04, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CWC27
Gene Description CWC27 spliceosome-associated protein homolog
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPH
Immunogen TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NY-CO-10, SDCCAG-10, SDCCAG10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6UX04
HTS Code 3002150000
Gene ID 10283
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CWC27 Antibody 25ul

Anti-CWC27 Antibody 25ul