NEIL3,FLJ10858,FPG2
  • NEIL3,FLJ10858,FPG2

Anti-NEIL3 Antibody 100ul

Ref: AN-HPA065761-100ul
Anti-NEIL3

Información del producto

Polyclonal Antibody against Human NEIL3, Gene description: nei-like DNA glycosylase 3, Alternative Gene Names: FLJ10858, FPG2, hFPG2, hNEI3, ZGRF3, Validated applications: ICC, Uniprot ID: Q8TAT5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NEIL3
Gene Description nei-like DNA glycosylase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC
Immunogen EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10858, FPG2, hFPG2, hNEI3, ZGRF3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TAT5
HTS Code 3002150000
Gene ID 55247
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NEIL3 Antibody 100ul

Anti-NEIL3 Antibody 100ul