LRR1,LRR-1,MGC20689
  • LRR1,LRR-1,MGC20689

Anti-LRR1 Antibody 25ul

Ref: AN-HPA065703-25ul
Anti-LRR1

Información del producto

Polyclonal Antibody against Human LRR1, Gene description: leucine rich repeat protein 1, Alternative Gene Names: LRR-1, MGC20689, PPIL5, Validated applications: IHC, Uniprot ID: Q96L50, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LRR1
Gene Description leucine rich repeat protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GSHIIPFHLCQDLDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDM
Immunogen GSHIIPFHLCQDLDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LRR-1, MGC20689, PPIL5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96L50
HTS Code 3002150000
Gene ID 122769
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LRR1 Antibody 25ul

Anti-LRR1 Antibody 25ul