TVP23C,FAM18B2
  • TVP23C,FAM18B2

Anti-TVP23C Antibody 100ul

Ref: AN-HPA065603-100ul
Anti-TVP23C

Información del producto

Polyclonal Antibody against Human TVP23C, Gene description: trans-golgi network vesicle protein 23 homolog C (S. cerevisiae), Alternative Gene Names: FAM18B2, MGC8763, Validated applications: ICC, Uniprot ID: Q96ET8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TVP23C
Gene Description trans-golgi network vesicle protein 23 homolog C (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MLQQDSNDDTEDVSLFDAEEETTNRPRKAK
Immunogen MLQQDSNDDTEDVSLFDAEEETTNRPRKAK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM18B2, MGC8763
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96ET8
HTS Code 3002150000
Gene ID 201158
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TVP23C Antibody 100ul

Anti-TVP23C Antibody 100ul