NFE2L1,FLJ00380
  • NFE2L1,FLJ00380

Anti-NFE2L1 Antibody 25ul

Ref: AN-HPA065424-25ul
Anti-NFE2L1

Información del producto

Polyclonal Antibody against Human NFE2L1, Gene description: nuclear factor, erythroid 2-like 1, Alternative Gene Names: FLJ00380, LCR-F1, NRF1, TCF11, Validated applications: IHC, Uniprot ID: Q14494, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NFE2L1
Gene Description nuclear factor, erythroid 2-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP
Immunogen LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ00380, LCR-F1, NRF1, TCF11
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14494
HTS Code 3002150000
Gene ID 4779
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NFE2L1 Antibody 25ul

Anti-NFE2L1 Antibody 25ul