SLC25A44,FLJ90431
  • SLC25A44,FLJ90431

Anti-SLC25A44 Antibody 100ul

Ref: AN-HPA065411-100ul
Anti-SLC25A44

Información del producto

Polyclonal Antibody against Human SLC25A44, Gene description: solute carrier family 25, member 44, Alternative Gene Names: FLJ90431, KIAA0446, Validated applications: ICC, Uniprot ID: Q96H78, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC25A44
Gene Description solute carrier family 25, member 44
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VVSQHLMMQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGF
Immunogen VVSQHLMMQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ90431, KIAA0446
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96H78
HTS Code 3002150000
Gene ID 9673
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC25A44 Antibody 100ul

Anti-SLC25A44 Antibody 100ul