SMIM12,C1orf212
  • SMIM12,C1orf212

Anti-SMIM12 Antibody 100ul

Ref: AN-HPA065331-100ul
Anti-SMIM12

Información del producto

Polyclonal Antibody against Human SMIM12, Gene description: small integral membrane protein 12, Alternative Gene Names: C1orf212, FLJ90372, Validated applications: ICC, IHC, WB, Uniprot ID: Q96EX1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SMIM12
Gene Description small integral membrane protein 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence LEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
Immunogen LEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf212, FLJ90372
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96EX1
HTS Code 3002150000
Gene ID 113444
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SMIM12 Antibody 100ul

Anti-SMIM12 Antibody 100ul