RPL37A,L37A
  • RPL37A,L37A

Anti-RPL37A Antibody 100ul

Ref: AN-HPA065327-100ul
Anti-RPL37A

Información del producto

Polyclonal Antibody against Human RPL37A, Gene description: ribosomal protein L37a, Alternative Gene Names: L37A, Validated applications: ICC, IHC, Uniprot ID: P61513, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RPL37A
Gene Description ribosomal protein L37a
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KMKRRAVGIWHCGSCVKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
Immunogen KMKRRAVGIWHCGSCVKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names L37A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61513
HTS Code 3002150000
Gene ID 6168
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPL37A Antibody 100ul

Anti-RPL37A Antibody 100ul