C12orf75,AGD3,OCC-1
  • C12orf75,AGD3,OCC-1

Anti-C12orf75 Antibody 100ul

Ref: AN-HPA065311-100ul
Anti-C12orf75

Información del producto

Polyclonal Antibody against Human C12orf75, Gene description: chromosome 12 open reading frame 75, Alternative Gene Names: AGD3, OCC-1, OCC1, Validated applications: ICC, IHC, Uniprot ID: Q8TAD7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C12orf75
Gene Description chromosome 12 open reading frame 75
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRK
Immunogen MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AGD3, OCC-1, OCC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TAD7
HTS Code 3002150000
Gene ID 387882
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C12orf75 Antibody 100ul

Anti-C12orf75 Antibody 100ul