FERMT3,KIND3
  • FERMT3,KIND3

Anti-FERMT3 Antibody 25ul

Ref: AN-HPA065231-25ul
Anti-FERMT3

Información del producto

Polyclonal Antibody against Human FERMT3, Gene description: fermitin family member 3, Alternative Gene Names: KIND3, MGC10966, MIG-2, MIG2B, UNC112C, URP2, Validated applications: ICC, Uniprot ID: Q86UX7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FERMT3
Gene Description fermitin family member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
Immunogen MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIND3, MGC10966, MIG-2, MIG2B, UNC112C, URP2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86UX7
HTS Code 3002150000
Gene ID 83706
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FERMT3 Antibody 25ul

Anti-FERMT3 Antibody 25ul